Cjc-1295 de Groeipeptides van de de Spierverhoging van Bodybuilding de Minimale Bijwerkingen met DAC

Productdetails:
Plaats van herkomst: China
Merknaam: FILTER
Certificering: GMP
Modelnummer: 863288-34-0
Betalen & Verzenden Algemene voorwaarden:
Min. bestelaantal: 10 flesjes
Prijs: Negotiable
Verpakking Details: 5mg/vial, 10mg/vial of zonodig
Levertijd: binnen 7 werkdagen
Betalingscondities: L/C, T/T, Western Union, MoneyGram, Alipay
Levering vermogen: 100000vials/month

Gedetailleerde informatie

Specificatie: 2mg/vial Verschijning: wit poeder
DeliveryTime: binnen 7 werkdagen Poort: Shanghai/Guangzhou/Hongkong
Pakket: Icebag, Discrete Verpakkingsmanieren voor uw verwijzing LimitNum: 10 flesjes
Zuiverheid: 99% Vervoer: DHL, Fedix, HKEMS, HKEUB, TNT
opslagruimte: droge, donkere en geventileerde plaats
Hoog licht:

growth hormone peptides

,

human growth hormone supplements

Productomschrijving

Peptide cjc-1295 van 2/5/10mg/Vial Bodybuilding met Dac CAS 863288-34-0

 

Beschrijving

Productnaam:

CJC1295

Synoniemen:

CJC1295; Y (D - A) DAIFTQSYRKVLAQLSARKLLQDILSR-NH2; L-Tyrosyl-D-alanyl-L-alpha-aspartyl-L-alanyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-glutaminyl-L-seryl-L-tyrosyl-L-arginyl-L-lysyl-L-valyl-L-leucyl-L-alanyl-L-glutaminyl-L-seryl-L-alanyl-L-arginyl-L-lysyl-L-leucyl-L-leucyl-L-glutaminyl-L-alpha-aspartyl-L-isoleucyl-L-leucyl-L-seryl-L-arginyl-N6- [3 (2,5-dihydro-2,5-dioxo-1H-pyrrol-1) - 1-oxopropyl] - l-Lysinamide; Cjc-1295 Acetaat; CJC1295 met uit DAC

CAS:

863288-34-0

MF:

C159H258N46O45

Mw:

0

EINECS:

 

Productcategorieën:

Peptides

 

 

Wat zou moeten worden opgemerkt?
1. Aangezien cjc-1295 enkel peptide en niet steroïden zijn, heeft het zeer minimale bijwerkingen. De mensen die hoge dosissen dit peptide gebruiken kunnen milde bijwerkingen zoals lange dromen die zij duidelijk kunnen herinneren, handen en vingers gaande verkleumde, saaie pijnen in de verbindingen, en zwakheid evenals losbolligheid ervaren als genoeg koolhydraten niet worden verbruikt.
2. Een andere bijwerking van cjc-1295 is acromegaly, aangezien het in het verhogen van de niveaus van het hormoon helpt. Acromegaly is een voorwaarde waar het extra de groeihormoon wordt vrijgegeven zelfs nadat de interne organen en het skelet het groeien hebben gebeëindigd. Dit veroorzaakt zich het dik maken van de huid, verdieping van stem, uitbreiding van kaken, en het uitonduidelijk spreken van toespraak. Een ander effect van acromegaly is het zwellen van het zachte weefsel in de interne organen. Dit kon in het verzwakken van de spieren van de interne organen, zoals het hart resulteren. Dit werd getest tijdens fase 2 het testen van cjc-1295.

 

Ons proces:
Het kwaliteitscontroleprocédé
1) Het kopen
Het grondige marktonderzoek, begrijpt de prijs van grondstoffen en prestaties. Aan de verwervingsbron volledig, volledig de kwaliteit van de verwerving van grondstoffen te begrijpen en te waarborgen.
2) Inspectie
Vier stappen: bemonstering, steekproefvoorbehandeling, het meten en gegevens - verwerking.
3) Het produceren
a) Elke exploitant moet zelfinspectie van producs doen en de overeenkomstige inspectieverslagen maken.
B) Volledige inspecteurs door controle de exploitantzelfinspectie, en overzicht en teken in het overeenkomstige verslag. De volledige inspectie is de oorzaak van inspectie van afgewerkt product, en maakt tot het afgewerkte product inkomende inspectieverslagen.
4) Alvorens te verkopen
Het testresultaat kan worden opgeleverd alvorens te verkopen.
De instelling van de derdeopsporing wordt toegestaan als u niet tevreden met testresultaten bent.


Onze voordelen:
1. Kwaliteit:
Ons bedrijf is een professionele productie van hormoontussenpersonen vele jaren, hebben onze producten uitgevoerd naar Duitsland, Spanje, het UK, de V.S., Australië, Midden-Oosten, etc. ander land, en wij hebben zeer goed terugkoppelen van onze klanten, kunt u op ons vertrouwen.
En wij zijn manufactory, zo geen probleem voor ons om de kwaliteit te controleren.
2. Betalingswijze: Western Union, TT.
3. De dienst: De beste dienst met de naverkoopdienst aan alle cliënten.
4. Levering:
Steekproeforde: Het pakket zal met 3days na betaling worden verscheept. Wij kunnen het via OMHOOGGAAND, EMS, de Luchtpost van HK, DHL verzenden of othermethod. Wij hebben een professionele en stabiele logistiek, en wij kunnen het pakket leveren regelmatig rond 3 tot 5 dagen.
Andere Peptide Onze Laboratoriumlevering:

Cjc-1295 de Groeipeptides van de de Spierverhoging van Bodybuilding de Minimale Bijwerkingen met DAC 0

 

Cjc-1295 de Groeipeptides van de de Spierverhoging van Bodybuilding de Minimale Bijwerkingen met DAC 1
 

Neem contact op met ons

Ga Uw Bericht in

Je zou deze kunnen zijn